Written by 5:30 am chat gpt צ׳אט ג׳יפיטי, llm, prompt engineering כתיבת פרומפט

שליטה מהירה בהנדסת פרומפט: חלק 3 – שליטה בהנדסת פרומפטים על מודלי AI שונים

dawnser prompt engineering

מָבוֹא

ברוכים הבאים לפרק השלישי והאחרון של המדריך המקיף שלנו להנדסה מהירה. בחלקים 1 ו-2, חקרנו את היסודות של הנדסה מהירה והעמקנו בטכניקות ואסטרטגיות מתקדמות. כעת, אנו מוכנים לקחת את הכישורים שלך לשלב הבא על ידי בחינת כיצד להתאים את הטכניקות ההנדסיות המהירות שלך על פני מודלים ויישומים שונים של AI.

ככל שנוף הבינה המלאכותית ממשיך להתפתח, עם דגמים ויכולות חדשות שצצים באופן קבוע, חיוני להבין כיצד להתאים את הגישה שלך לארכיטקטורות שונות של AI ולמקרי שימוש. בפוסט זה, נחקור את הניואנסים של הנחיה מסוגים שונים של מודלים של AI, נדון כיצד לבצע אופטימיזציה למשימות ספציפיות, ונסתכל על העתיד של הנדסה מהירה.

הבנת ארכיטקטורות מודל AI שונות

לפני שנצלול לתוך אסטרטגיות הנחיה ספציפיות, חיוני להבין את הארכיטקטורות הבסיסיות של מודלים שונים של AI. ידע זה יעזור לך ליצור הנחיות יעילות יותר עבור כל סוג של דגם.

1. מודלים של שפה גדולה (LLMs)

דוגמאות: GPT-3, GPT-4, BERT, T5

מאפיינים:

  • מאומן על כמויות אדירות של נתוני טקסט
  • יכול ליצור טקסט דמוי אדם ולבצע משימות שפה שונות
  • משמש לעתים קרובות להשלמת טקסט, תרגום, סיכום ותשובות לשאלות

שיקולים מעוררים:

  • תיהנו מהוראות ברורות ומפורטות
  • יכול להתמודד עם הקשר ובקשות ניואנסים
  • עשוי לדרוש "פריינג" עם דוגמאות למשימות מיוחדות

2. מודלים ליצירת תמונה

דוגמאות: DALL-E, Midjourney, Stable Diffusion

מאפיינים:

  • יכול ליצור תמונות מתיאורי טקסט
  • מאומן על צמדי תמונה-טקסט
  • מסוגל ליצור, לערוך ולתפעל תמונות

שיקולים מעוררים:

  • דורש תיאורים חזותיים מפורטים
  • תהנה מהפניות לסגנון ספציפי
  • עשוי להזדקק להדרכה על קומפוזיציה ואלמנטים אמנותיים

3. דגמים רב-מודאליים

דוגמאות: GPT-4 (עם קלט תמונה), CLIP

מאפיינים:

  • יכול לעבד וליצור תוכן על פני אופנים שונים (למשל, טקסט ותמונות)
  • מסוגל להבין הקשר בין אופנים

שיקולים מעוררים:

  • יכול למנף קלט טקסטואלי וחזותי כאחד
  • דרוש הנחיות ברורות כיצד להשתמש במידע רב-מודאלי
  • הפיק תועלת מהנחיות המקשרות במפורש שיטות שונות

4. מודלים מיוחדים למשימות

דוגמאות: CodeX (לקידוד), AlphaFold (לקיפול חלבון)

מאפיינים:

  • מותאם עבור דומיינים או משימות ספציפיות
  • לעיתים קרובות יש להם ידע מעמיק ומיוחד בתחום המיקוד שלהם

שיקולים מעוררים:

  • דורשים שפה ומושגים ספציפיים לתחום
  • תיהנו מעיצוב וממוסכמות ספציפיות למשימה
  • ייתכן שיהיה צורך בהוראות מפורשות על פורמט הפלט

התאמת הנחיות לדגמי AI שונים

כעת, לאחר שהבנו את הארכיטקטורות הבסיסיות, בואו נחקור כיצד להתאים את ההנחיות שלנו לכל סוג של דגם.

1. הנחיה למודלים גדולים של שפה (LLMs)

כשאתה עובד עם לימודי LLM, נצל את היכולת שלהם להבין הקשר וניואנסים. הנה כמה אסטרטגיות:

א. השתמש בהוראות ברורות ומובנות

דוּגמָה:

Please provide a comprehensive analysis of the potential economic impacts of widespread automation in the manufacturing sector. Structure your response as follows:

1. Introduction: Brief overview of automation in manufacturing
2. Short-term impacts (1-5 years):
   a. Employment changes
   b. Productivity gains
   c. Cost implications for businesses
3. Long-term impacts (5-20 years):
   a. Shifts in workforce skills and education
   b. Changes in global competitiveness
   c. Potential societal changes
4. Challenges and opportunities:
   a. For businesses
   b. For workers
   c. For policymakers
5. Conclusion: Summary of key points and potential future scenarios

For each section, provide specific examples and data where relevant. Maintain an objective tone throughout the analysis.

ב. מנף משחק תפקידים לידע מיוחד

דוּגמָה:

Assume the role of a seasoned environmental lawyer specializing in international climate agreements. I need your expertise to:

1. Explain the key differences between the Paris Agreement and the Kyoto Protocol.
2. Analyze the strengths and weaknesses of the Paris Agreement's enforcement mechanisms.
3. Suggest three potential improvements to make international climate agreements more effective, citing specific legal and diplomatic considerations.

Please use appropriate legal terminology and reference relevant case studies or precedents where applicable.

ג. השתמש בלמידה של כמה יריות לקבלת תפוקות עקביות

דוּגמָה:

I need you to generate headlines for a tech news website. The headlines should be attention-grabbing but not clickbait, informative, and follow AP style. Here are three examples of the style we're aiming for:

1. "Apple Unveils iPhone 15 with Groundbreaking AI Capabilities"
2. "SpaceX Successfully Lands First Crewed Mission on Mars"
3. "Google's Quantum Computer Achieves 'Quantum Supremacy' in Landmark Study"

Now, please generate 5 headlines in this style for the following topics:
1. A new breakthrough in renewable energy storage
2. The launch of a global cryptocurrency by a consortium of tech giants
3. A major cybersecurity attack on government infrastructure
4. The discovery of a potentially habitable exoplanet
5. The release of a revolutionary brain-computer interface

2. הנחיה לדגמי יצירת תמונה

כשאתה עובד עם מודלים ליצירת תמונות, התמקד במתן תיאורים חזותיים מפורטים והפניות לסגנון. הנה כמה אסטרטגיות:

א. השתמש בתיאורים חזותיים מפורטים

דוּגמָה:

Generate an image with the following elements:

- Scene: A futuristic cityscape at sunset
- Foreground: A sleek, hovering electric car with glowing blue accents
- Middle ground: Tall, curved skyscrapers with vertical gardens
- Background: A large, orange sun setting behind purple-tinged clouds
- Lighting: Warm, golden light from the sunset, with cool blue highlights from the city's neon signs
- Style: Photorealistic with a slight cyberpunk influence
- Composition: Wide shot with the hovering car slightly off-center to the left

Additional details:
- The car should have no visible wheels and appear to be floating about a foot off the ground
- Include pedestrians on elevated walkways between buildings
- Add flying drones in the distance
- Ensure the architecture has a mix of glass, metal, and green elements

ב. התייחסות לסגנונות אמנותיים ספציפיים

דוּגמָה:

Create an image in the style of Vincent van Gogh's "Starry Night," but with the following changes:

- Instead of a village, depict a modern city skyline
- Replace the large cypress tree with a futuristic space elevator extending into the sky
- Maintain the swirling, expressive sky, but incorporate subtle constellations
- Use a color palette that leans more towards cool blues and purples, with hints of warm yellows and oranges
- Keep the impasto technique and visible brushstrokes characteristic of van Gogh's style

Ensure that the overall composition and emotional impact are reminiscent of the original "Starry Night" while incorporating these modern and futuristic elements.

ג. ספק מידע הקשרי

דוּגמָה:

Generate a movie poster for a sci-fi thriller with the following details:

- Title: "Quantum Nexus"
- Tagline: "The future is a paradox"
- Setting: A world where time travel is possible but strictly regulated
- Main character: A rogue time agent trying to prevent a catastrophic event
- Tone: Dark, intense, and mysterious
- Visual style: Blend of noir and futuristic elements

Key elements to include:
- The main character in the foreground, face partially obscured, wearing a sleek, high-tech suit
- A fractured or glitching effect to suggest timeline disruptions
- A looming, ominous structure in the background (the Quantum Nexus)
- Subtle time-related imagery (e.g., clocks, hourglasses) integrated into the design
- Use a color scheme dominated by deep blues and purples with sharp contrasts

The poster should convey a sense of urgency and the high stakes of the story while maintaining an air of mystery about the exact nature of the threat.

3. הנחיה למודלים רב-מודאליים

כאשר עובדים עם מודלים רב-מודאליים, חיוני לספק הנחיות ברורות כיצד להשתמש ולשלב מידע משיטות שונות. הנה כמה אסטרטגיות:

א. שלב קלט חזותי וטקסטואלי

דוּגמָה:

[Assume an image of a complex mechanical device has been uploaded]

Analyze the image provided and perform the following tasks:

1. Identify the type of mechanical device shown in the image.
2. List the main components visible in the image, using technical terminology where appropriate.
3. Based on the visible components and their arrangement, explain the likely function of this device.
4. Identify any unusual or innovative features in the design.
5. Suggest potential improvements or modifications to enhance the device's efficiency or functionality.
6. Compare this device to similar ones you're aware of, highlighting key differences or advancements.

In your analysis, refer to specific visual elements in the image to support your points. If you need any clarification about particular parts of the image, please ask.

ב. צור פלטים רב-מודאליים

דוּגמָה:

Create a comprehensive educational resource about the water cycle for middle school students. This resource should include both textual and visual elements. Please provide:

1. A clear, concise textual explanation of the water cycle, including key terms such as evaporation, condensation, precipitation, and collection. The explanation should be appropriate for a middle school reading level.

2. A diagram of the water cycle that visually represents the process described in the text. The diagram should:
   - Show the circular nature of the water cycle
   - Include labels for each stage of the cycle
   - Use colors effectively to distinguish different elements (e.g., water, clouds, sun)
   - Incorporate simple icons or illustrations to represent key components (e.g., mountains, oceans, plants)

3. A list of 3-5 interesting facts about the water cycle that are not included in the main explanation.

4. A simple infographic that presents statistical information about water distribution on Earth (e.g., percentage of freshwater vs. saltwater, distribution of freshwater in glaciers, groundwater, and surface water).

Ensure that the textual and visual elements complement each other and create a cohesive, engaging learning resource.

ג. ניתוח חוצה-מודאלי

דוּגמָה:

[Assume an image of a painting and a poem have been provided]

Perform a comparative analysis of the provided painting and poem, exploring their thematic and stylistic connections. Your analysis should:

1. Describe the key visual elements of the painting, including subject matter, color palette, composition, and artistic style.

2. Summarize the main themes, imagery, and poetic devices used in the poem.

3. Identify and explain at least three connections between the painting and the poem. These could include:
   - Shared themes or motifs
   - Similar emotional tones
   - Corresponding use of color (in the painting) and imagery (in the poem)
   - Parallel structural elements

4. Discuss how each work might inform or enhance the interpretation of the other.

5. Speculate on whether the artist and poet might have been influenced by similar cultural or historical factors, based on the content and style of their works.

6. Suggest how these two works could be used together in an educational or artistic context to deepen understanding of their shared themes.

In your analysis, explicitly reference specific elements from both the visual and textual works to support your points.

4. הנחיית מודלים מיוחדים למשימות

כשעובדים עם מודלים מיוחדים של משימות, חשוב להשתמש בשפה ספציפית לתחום ולדבוק במוסכמות הרלוונטיות. הנה כמה אסטרטגיות:

א. משימות קידוד (למשל, עבור דגמים כמו CodeX)

דוּגמָה:

Please write a Python function that implements a basic recommendation system using collaborative filtering. The function should have the following specifications:

1. Function name: `collaborative_filter`
2. Parameters:
   - `user_item_matrix`: A 2D numpy array where rows represent users and columns represent items. Each cell contains the rating given by a user to an item, or 0 if no rating was given.
   - `user_id`: The ID of the user for whom we're making recommendations (integer)
   - `k`: The number of similar users to consider (integer)
   - `n`: The number of top recommendations to return (integer)

3. The function should:
   - Find the k most similar users to the given user using cosine similarity
   - Calculate the weighted average of these users' ratings for items the given user hasn't rated
   - Return the top n items with the highest predicted ratings

4. Return value: A list of tuples, where each tuple contains (item_id, predicted_rating), sorted by predicted_rating in descending order

5. Include appropriate error handling and input validation

6. Use numpy for efficient array operations where possible

7. Include clear, concise comments explaining the main steps of the algorithm

8. Follow PEP 8 style guidelines

After the function, please provide a brief explanation of how collaborative filtering works and the pros and cons of this approach to recommendation systems.

ב. משימות ניתוח מדעי (למשל, עבור מודלים כמו AlphaFold)

דוּגמָה:

Analyze the following protein sequence and provide a comprehensive structural prediction report:

Sequence: MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADVLASHGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQRLGSADAAAAAMKRHGRSVETELVSEMEDTQKAL

Please provide the following in your analysis:

1. Secondary structure prediction:
   - Percentage of alpha-helices, beta-sheets, and random coils
   - A visual representation of the predicted secondary structure along the sequence

2. Tertiary structure prediction:
   - A description of the overall predicted 3D structure
   - Identification of any predicted domains or motifs
   - Confidence score for the overall prediction

3. Functional analysis:
   - Predicted protein family or superfamily
   - Potential binding sites or active sites
   - Any identified sequence motifs associated with specific functions

4. Stability analysis:
   - Predicted stability of the protein structure
   - Any regions of high flexibility or disorder

5. Evolutionary conservation:
   - Identification of highly conserved regions
   - Potential evolutionary relationships to known protein families

6. Potential post-translational modifications:
   - Predicted glycosylation, phosphorylation, or other modification sites

7. Suggestions for experimental validation:
   - Key regions to target for mutagenesis studies
   - Potential approaches for structural determination (e.g., X-ray crystallography, NMR)

Please provide your analysis in a clear, structured format, using appropriate scientific terminology. Include a brief explanation of the methods or algorithms used for each prediction, and note any limitations or uncertainties in the analysis.

אופטימיזציה של הנחיות עבור משימות ספציפיות

משימות שונות דורשות אסטרטגיות הנחיה שונות. להלן כמה טיפים למיטוב הנחיות עבור יישומי AI נפוצים:

1. סיכום טקסט

  • ציין את האורך הרצוי או את נקודות המפתח לכלול
  • ציין את קהל היעד ומטרת הסיכום
  • בקש סגנון ספציפי (למשל, נקודות תבליטים, נרטיב, תקציר מנהלים)

דוּגמָה:

Summarize the following research paper for a general audience with some scientific background. Your summary should:

1. Be approximately 250 words long
2. Highlight the main research question, methodology, key findings, and implications
3. Avoid jargon, but maintain scientific accuracy
4. Use a clear, engaging style suitable for a popular science magazine
5. Include a brief "Why it matters" section at the end, explaining the broader impact of this research

Paper title: "Quantum Entanglement in Photosynthetic Light-Harvesting Complexes"

[Insert paper abstract or full text here]

2. יצירת תוכן

  • ספק קווים מנחים ברורים לגבי טון, סגנון וקהל יעד
  • ציין את כל הסעיפים או האלמנטים המבניים הנדרשים
  • כלול דוגמאות של פלט רצוי במידת האפשר

דוגמה:
"`
צרו פוסט בבלוג על החשיבות של תכנון עירוני בר-קיימא. הפוסט צריך:

  1. אורכו כ-800 מילים
  2. פנה לקהל של אנשי מקצוע צעירים המתעניינים בנושאי סביבה
  3. השתמש בנימה שיחתית אך אינפורמטיבית
  4. כלול את הסעיפים הבאים:
  • מָבוֹא
  • האתגרים של עיור מהיר
  • עקרונות מפתח של תכנון עירוני בר קיימא
  • דוגמאות מהעולם האמיתי של ערים מצליחות בת קיימא
  • תפקידה של הטכנולוגיה בפיתוח עירוני בר קיימא
    [mc4wp_form id="5878"]